- Methionyl tRNA synthetase 2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92106
- COXPD25, MetRS, mtMetRS
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: WLGTVLHVAL ECLRVFGTLL QPVTPSLADK LLSRLGVSAS ERSLGELYFL PRFYGHPCPF EGRRLGPETG LLFPRLDQSR TWLVKAHRT
- Methionyl tRNA synthetase 2
- Human
- 0.1 ml (also 25ul)
- methionyl-tRNA synthetase 2, mitochondrial
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Primary Antibodies
Sequence
WLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT
Specifications/Features
Available conjugates: Unconjugated